HomepageFonts CategoriesStylesStencil, Army
Dustin Norlander

wargames font

By Cheapskate Fonts
wargameswargameswargameswargameswargames
Download (zip 7.7 Kb)Add to favouritesReport this font
  • Styles (1)
  • Character Maps
  • License
1 styles for
83 characters
wargameswargameswargames
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

I recently got the DVD for the movie "wargames". This is a great old movie. It is the whole reason I got into computers. I always dreamed of changing my grades in highschool. (It never happened) heh.. Anyway, enjoy the font.

Read more

Have a free font, Jerk!
Check out my other fonts..
http://www.cheapskatefonts/
feel free to distribute this font as long as you include this readme file.
Thanx, enjoy the font!

science-fictionarmyledpixelmoviewargamesheavydisplaypatternedcheapskate fontscheapskate fontswargames

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version