HomepageFonts CategoriesTechnoPixel / Bitmap
Fonts me

uni 05_53 Font font

By
uni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Font
Download (zip 72.0 Kb)Add to favouritesReport this font
  • Styles (4)
  • Character Maps
  • License
4 styles for
711 characters
uni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Fontuni 05_53 Font
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed
pixeluniregularmacromediafontographerfontspecificwwwminimldesigncraigkroegeruni 05_53 fontuni 05_53uni 05_54uni 05_63uni 05_64uni 05_53 font05_5305_5405_6305_64

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version