HomepageFonts CategoriesStylesDesign
Fonts me

TTBlushes-ThinDEMO Font font

By TypeType - Website: www.typetype.ru
TTBlushes-ThinDEMO FontTTBlushes-ThinDEMO FontTTBlushes-ThinDEMO FontTTBlushes-ThinDEMO FontTTBlushes-ThinDEMO FontTTBlushes-ThinDEMO Font
Download (zip 353.4 Kb)Add to favouritesReport this font
  • Styles (1)
  • Character Maps
  • License
1 styles for
192 characters
TTBlushes-ThinDEMO FontTTBlushes-ThinDEMO FontTTBlushes-ThinDEMO FontTTBlushes-ThinDEMO FontTTBlushes-ThinDEMO Font
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed
farsittblushesthindemocopyright(c)typetype.designerivangladkikhtechnicalmariamisernitskaya.reserved.ttblushes-thindemo fonttt blushes thin demotypetypetypetypettblushes-thindemo fontttblushes-thindemottblushesthindemo

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version