HomepageFonts CategoriesFonts OnlineAncient
Vladimir Nikolic

Rise of Kingdom font

By vladimirnikolic
Rise of KingdomRise of KingdomRise of KingdomRise of Kingdom
Download (zip 19.5 Kb)Add to favouritesReport this font
  • Styles (1)
  • Character Maps
  • License
1 styles for
81 characters
Rise of KingdomRise of KingdomRise of Kingdom
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

Medieval royal look serif font.100% free for personal and commercial usage

regularsmall capsroyalkingdomancientmedievalserifheadlinesglyphicgame of thronessmalvladimirnikolicrise of kingdomrise of kingdom regularvladimirnikolicrise of kingdomrise

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version