HomepageFonts CategoriesStylesHandwritten

Renegade font

By Font Bundles
RenegadeRenegadeRenegadeRenegade
Download (zip 280.2 Kb)Add to favouritesReport this font
  • Styles (2)
  • Character Maps
  • License
2 styles for
328 characters
RenegadeRenegadeRenegadeRenegadeRenegadeRenegadeRenegadeRenegadeRenegade
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

This font is free for Personal and Commercial Use.
This free font comes with our Premium License which allows Commercial and Personal Use.
You can find the license here: fontbundles.net/license

heavyhandwrittendisplaymarkercaps onlyrebelbrushhanddrawnhandletteringprotestdystopiaboldfont bundlesrenegaderenegade regular

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version