HomepageFonts CategoriesStylesDesign
Fikry Alif

Persian Cotage font

By fikryal - E-mail: [email protected]
Persian CotagePersian CotagePersian CotagePersian CotagePersian CotagePersian CotagePersian Cotage
Download (zip 62.8 Kb)Add to favouritesReport this font
  • Styles (1)
  • Character Maps
  • License
1 styles for
239 characters
Persian CotagePersian CotagePersian CotagePersian CotagePersian CotagePersian Cotage
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

this font just demo, if you want to get this font for commercial use , please visit link below
https://fontbundles.net/fikryal/422923-persian-cotage-handwritten-font

advertisementsbrandinginvitationlabellogoproduct-designsproduct-packagingsocial-media-poststittlewedding-designsfikryalpersian cotage

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version