HomepageFonts CategoriesStylesBrush
Tom Jerry
Locare Brush modernLocare Brush modernLocare Brush modernLocare Brush modernLocare Brush modern
Download (zip 94.7 Kb)Add to favouritesReport this font
  • Styles (2)
  • Character Maps
  • License
2 styles for
210 characters
Locare Brush modernLocare Brush modernLocare Brush modernLocare Brush modernLocare Brush modernLocare Brush modern
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

Locare Brush Font is modern brush font which is waiting to be used for your next project! This font is perfect for making logo’s, invites, quotes, photo overlays, and any other awesome projects you’re working on.

5/5(1vote )

Locare Brush Font is modern brush font which is waiting to be used for your next project! This font is perfect for making logo's, invites, quotes, photo

brushcomicscriptbrandingcalligraphyelegantfontfont!grungehandmadehandwrittenletteringlocare brushlocare fontlocare scriptlogomodernsimpletypefacevintagemiftahlocare

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version