HomepageFonts CategoriesBasicItalic
Vincenzo Vuono

Gravity font

By Vincenzo Vuono - E-mail: [email protected]
GravityGravityGravityGravityGravity
Download (zip 232.9 Kb)Add to favouritesReport this font
  • Styles (10)
  • Character Maps
  • License
10 styles for
303 characters
GravityGravityGravityGravityGravityGravityGravityGravity
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

Gravity is a typographic experiment, born from the desire to deepen my knowledge about this discipline.
Gravity is also a new geometric sans serif typeface designed with balance and large counters.
The typeface uses the "gravity" as a distinctive, functional and aesthetic feature of the font. It is going
to be used as official font by "Accademia di Belle Arti Palermo".

Gravity is also my first typeface. Hope you enjoy!
If you want to try it, download it for free

© Vincenzo Vuono
www.vincenzovuono.com!

boldbookfamilygravityitaliclightlinearregularsanssans-serifultralightvincenzo vuonovincenzo vuonogravity

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version