HomepageFonts CategoriesFonts OnlineTyperwriter
Down fonts

Ernst font

By Michael Schink - Website: www.greatmade.de
ErnstErnstErnstErnst
Download (zip 111.2 Kb)Add to favouritesReport this font
  • Styles (2)
  • Character Maps
  • License
2 styles for
158 characters
ErnstErnstErnstErnst
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

This font is freeware for personal and commercial use.
Feel free to distribute this font.
You are permitted to put this font on CDs, websites,... with the following restrictions:

michael schinkernsttyperwriterfancymichael schinkernst

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version