HomepageFonts CategoriesFonts OnlineFancy
Down fonts

Dark Magic font

By typefactory
Dark MagicDark MagicDark MagicDark MagicDark MagicDark MagicDark MagicDark MagicDark Magic
Download (zip 219.8 Kb)Add to favouritesReport this font
  • Styles (2)
  • Character Maps
  • License
2 styles for
187 characters
Dark MagicDark MagicDark MagicDark MagicDark Magic
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

Dark Magic is a bold, gothic styled blackletter font. It is imposing and incredibly adept for designs requiring a strong touch and classic design. Add it confidently to your projects, and you won’t be disappointed.
Full Version Download Here :

https://typefactory.co/product/dark-magic-blackletter-typeface/

https://www.creativefabrica.com/product/dark-magic/ref/236390/

Read more

license: Freeware, Non-Commercial
link: https://www.fontspace.com/dark-magic-font-f54796

fancyold englishhand letteringmedievalblacklettervictorianhand drawnclassymagicrenaissancetypefactorydark magic

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version