HomepageFonts CategoriesRelaxCartoon
Type Factory

Combust font

By TypeFactory Co
CombustCombustCombustCombustCombustCombustCombustCombustCombust
Download (zip 618.5 Kb)Add to favouritesReport this font
  • Styles (2)
  • Character Maps
  • License
2 styles for
305 characters
CombustCombustCombustCombustCombustCombustCombustCombust
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

Combust is a modern playful display font with fire.The font is thick so it can still be read even if there is a burning fire, suitable for various purposes, poster design, for video game or movie titles, or promotions on social media.Full Version Download Here :typefactory.co/product/combust-playful-fire-display/www.creativefabrica.com/product/combust/ref/501262/

blazebonfireburntcartooncomiccookingdangerdisplayfastfieryflamefungrillheathorrorhottypefactory cocombustcombust regular

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version