HomepageFonts CategoriesStylesBrush
Down fonts

Coconut House font

By Joe Letter - E-mail: [email protected]
Coconut HouseCoconut HouseCoconut HouseCoconut House
Download (zip 20.1 Kb)Add to favouritesReport this font
  • Styles (1)
  • Character Maps
  • License
1 styles for
100 characters
Coconut HouseCoconut HouseCoconut House
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

Thanks for downloading.

This font is free for personal and commercial use.

If you make any money using this font, it would be nice if you could throw me a few bucks. Any amount would be greatly appreciated.

Creative Commons Attribution-ShareAlike License. http://creativecommons.org/licenses/by-sa/3.0/

Read more

license: Creative Commons (by-sa) Attribution Share Alike
link: https://www.fontspace.com/coconut-house-font-f51061

brushcomiccartoonhand drawnthickdisplayfreehandmarkerjoe lettercoconut house

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version