HomepageFonts CategoriesStylesCalligraphy

Cipsta font

By Ryan Rivaldo Vierra
CipstaCipstaCipstaCipstaCipstaCipstaCipstaCipstaCipsta
Download (zip 161.3 Kb)Donate moneyAdd to favouritesReport this font
  • Styles (2)
  • Character Maps
  • License
2 styles for
223 characters
CipstaCipstaCipstaCipstaCipstaCipsta
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

Cipsta Scipt is a lovely and flowing handwritten font. It will add a luxury spark to any design project that you wish to create! This font is PUA encoded which means you can access all of the amazing glyphs and ligatures with ease!

Read more

Hello,

Thank for purchasing and using my font.


How to Instal : Just dobble click file font and instal (windows)

How to Using Special Characters

https://helpx.adobe.com/illustrator/using/special-characters.html

Ryan Rivaldo Vierra

heavydisplaycalligraphyhanddrawnscriptmoderncursiveretrovintagehandletteringbrushbrush peryan rivaldo vierracipstacipsta regular

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version