HomepageFonts CategoriesFonts OnlineFancy
Down fonts

c Camkan font

By wepfont - E-mail: [email protected]
c Camkanc Camkanc Camkanc Camkan
Download (zip 17.6 Kb)Add to favouritesReport this font
  • Styles (1)
  • Character Maps
  • License
1 styles for
95 characters
c Camkanc Camkanc Camkan
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

keep that in mind

Read more

license: Freeware
link: https://www.fontspace.com/c-camkan-font-f63786

coolfancypostergroovywavydistortedblock letteringdisplaymindreminderwepfontc camkan

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version