HomepageFonts CategoriesBasicSans serif
SnapeFonts

Block Helvetica font

By SnapeFonts - E-mail: [email protected]
Block HelveticaBlock HelveticaBlock HelveticaBlock HelveticaBlock HelveticaBlock HelveticaBlock Helvetica
Download (zip 27.5 Kb)Add to favouritesReport this font
  • Styles (1)
  • Character Maps
  • License
1 styles for
231 characters
Block HelveticaBlock HelveticaBlock HelveticaBlock HelveticaBlock HelveticaBlock Helvetica
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

A typeface I made for Initial Caps and keycaps for a computer book.

Read more

license: Public Domain
link: https://www.fontspace.com/block-helvetica-font-f49694

sans serifhelveticainitialskeycapssnapefontsblock helvetica

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version