HomepageFonts CategoriesStylesDesign
Fonts me

TTBellsDEMO Font font

By TypeType - Website: www.typetype.ru
TTBellsDEMO FontTTBellsDEMO FontTTBellsDEMO FontTTBellsDEMO FontTTBellsDEMO Font
Download (zip 412.3 Kb)Add to favouritesReport this font
  • Styles (1)
  • Character Maps
  • License
1 styles for
196 characters
TTBellsDEMO FontTTBellsDEMO FontTTBellsDEMO FontTTBellsDEMO FontTTBellsDEMO Font
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed
farsittbellsdemocopyright(c)typetype.designerivangladkikhtechnicaldesignersnadyrrakhimov&olexavolochay.reserved.ttbellsdemo fonttt bells demotypetypetypetypettbellsdemo fontttbellsdemo

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version