HomepageFonts CategoriesStylesCalligraphy
Iconian Fonts
The Shire calligraphicThe Shire calligraphicThe Shire calligraphicThe Shire calligraphicThe Shire calligraphicThe Shire calligraphic
Download (zip 340.7 Kb)Add to favouritesReport this font
  • Styles (10)
  • Character Maps
  • License
10 styles for
219 characters
The Shire calligraphicThe Shire calligraphicThe Shire calligraphicThe Shire calligraphicThe Shire calligraphicThe Shire calligraphic
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

For information on commercial use, please visit www.iconian.com/commercial.html

Read more

The Shire Truetype Font for Windows Version 1.1

2009 Iconian Fonts - Daniel Zadorozny

http://www.iconian.com/

This font comes with the following 10 versions: Regular, Italic, Condensed, Condensed Italic, Expanded, Expanded Italic, Bold, Bold Italic, Bold Condensed and Leftalic.

This font may be freely distributed and is free for all non-commercial uses. Use of the fonts are at your own risk. This font is e-mailware; that is, if you like it, please e-mail the author at:

[email protected]

bilbo bagginscalligraphiccalligraphydecorativehobbitsjrr tolkienlightlord of the ringsmedievalscriptserifswirlsthe hobbittolkienuncialiconian fontsthe shirethe shire boldthe shire bold condensedthe shire bold italicthe shire conde

Comments

no-avatar

Advertise

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version