HomepageFonts CategoriesFonts OnlineTyperwriter
Down fonts

Old Typewriter font

By M-Dfonts - Website: photo.design-studio.sk
Old TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld Typewriter
Download (zip 26.2 Kb)Add to favouritesReport this font
  • Styles (1)
  • Character Maps
  • License
1 styles for
656 characters
Old TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld TypewriterOld Typewriter
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

This font is free for personal use. For any commercial use please contact me.

note: major update 10.09.2015
added some special symbols and characters
updated, aligned and size adjusted all characters should be placed more accurately.

Website: http://photo.design-studio.sk

m-dfontsold typewritertyperwriterfancym-dfontsold typewriteroldtypewriter

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version