HomepageFonts CategoriesStylesCalligraphy
Fonts me
Lady Copra Alternate FontLady Copra Alternate FontLady Copra Alternate FontLady Copra Alternate FontLady Copra Alternate FontLady Copra Alternate Font
Download (zip 141.8 Kb)Add to favouritesReport this font
  • Styles (4)
  • Character Maps
  • License
4 styles for
229 characters
Lady Copra Alternate FontLady Copra Alternate FontLady Copra Alternate FontLady Copra Alternate FontLady Copra Alternate FontLady Copra Alternate Font
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed
typewriterladycopraalternateregularfontspecificgrahammeadevisitwwwapostrophiclabemailformoreinfolady copra alternate fontlady copra alternatelady copra narrowlady copra widelady copragraham meadegraham meadelady copra alternate

Comments

no-avatar

Advertise

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version