HomepageFonts CategoriesFonts OnlineFancy
Pixel Kitchen

Junglira font

By Pixel Kitchen - E-mail: [email protected]
JungliraJungliraJungliraJungliraJungliraJungliraJungliraJungliraJunglira
Download (zip 13.6 Kb)Add to favouritesReport this font
  • Styles (1)
  • Character Maps
  • License
1 styles for
254 characters
JungliraJungliraJungliraJungliraJungliraJungliraJunglira
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

A slightly leafy engraving-style Decolike. Supports Danish, Dutch, English, Finnish, French, German, Hungarian, Icelandic, Italian, Norwegian, Polish, Portuguese, Spanish, and Swedish!

The font seems to have bugged out a bit on the initial upload... apologies to those who experienced that!

decolikedisplayengravedfancyfreehigh-contrastpublic-domainsans-serifpixel kitchenjunglira

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version