HomepageFonts CategoriesStylesCalligraphy
Down fonts

Flower White font

By Arlianstudio - E-mail: [email protected]
Flower WhiteFlower WhiteFlower WhiteFlower WhiteFlower White
Download (zip 50.8 Kb)Add to favouritesReport this font
  • Styles (1)
  • Character Maps
  • License
1 styles for
124 characters
Flower WhiteFlower WhiteFlower WhiteFlower White
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

This font is only used for demo (DEMO License). If you want to use this font for commercial use, please contact [email protected]

Read more

license: Freeware, Non-Commercial
link: https://www.fontspace.com/flower-white-font-f43776

calligraphycursivescriptweddingfemininegirlyarlianstudioflower white

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version