HomepageFonts CategoriesBasicSans serif
Alit Design

Brostel font

By Alit Design - E-mail: [email protected]
BrostelBrostelBrostelBrostelBrostelBrostelBrostelBrostel
Download (zip 134.0 Kb)Add to favouritesReport this font
  • Styles (1)
  • Character Maps
  • License
1 styles for
119 characters
BrostelBrostelBrostel
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

This is font Demo just for personal use, Not permitted for commercial use.
The donation is very appreciated.

Please check here for more info about the license:
https://alitdesign.net/license/

DOWNLOAD FULL VERSION: https://alitdesign.net/product/brostel-typeface/

visit my website for full version and commercial use: https://alitdesign.net/

follow my Instagram to update my portfolio: https://www.instagram.com/alitdesign_studio/

Read more

license: Freeware, Non-Commercial
link: https://www.fontspace.com/brostel-medium-font-f93890

sans serifmodernthindisplayfamilyheavyhighsportsalit designbrostel

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version