HomepageFonts CategoriesBasicSans serif
Amera Type

AT-Askara (demo) font

By AmeraType
AT-Askara (demo)AT-Askara (demo)AT-Askara (demo)AT-Askara (demo)
Download (zip 53.1 Kb)Add to favouritesReport this font
  • Styles (1)
  • Character Maps
  • License
1 styles for
254 characters
AT-Askara (demo)AT-Askara (demo)AT-Askara (demo)AT-Askara (demo)AT-Askara (demo)AT-Askara (demo)AT-Askara (demo)
  • Free for Personal Use
  • Free for Commercial Use

Extended information

Copyright (c) 2020 by Amera Type. All rights reserved. For other products www.myfonts.com/foundry/amera-type/

regularall capsserifheadlineameratypeat-askara (demo)at-askara font designed by cahyadi and ikhsan

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version