HomepageFonts CategoriesBasic
Tom Jerry

Archives Light font

By mynameisyanick - Website: www.behance.net
Archives LightArchives LightArchives LightArchives LightArchives Light
Download (zip 206.5 Kb)Add to favouritesReport this font
  • Styles (10)
  • Character Maps
  • License
10 styles for
112 characters
Archives LightArchives LightArchives Light
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

Six Fonts Bundle
TTF, OTF, SVG | 982 KB

basic fontboldbundlehand drawnhandmadelightlogosix fontssix fonts bundlevintagearchives lightbiarritzcharlies boldriot gothicruff draftsarifamynameisyanickmynameisyanickarchives lightarchivescharliesriotgothicruffdraft

Comments

no-avatar

Advertise

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version