HomepageFonts CategoriesFonts OnlineGraffiti
Down fonts

a Attack Graffiti font

By wepfont
a Attack Graffitia Attack Graffitia Attack Graffitia Attack Graffiti
Download (zip 43.8 Kb)Add to favouritesReport this font
  • Styles (2)
  • Character Maps
  • License
2 styles for
97 characters
a Attack Graffitia Attack Graffitia Attack Graffiti
  • Free for Personal Use
  • Free for Commercial Use
  • Modification Allowed
  • Redistribution Allowed

Extended information

100% attack

Read more

license: Freeware
link: https://www.fontspace.com/a-attack-graffiti-font-f45529

coolbolddrippingdrawfreestylegraffitiliquidpaintpunkspray paintstyletagurbanwepfonta attack graffiti

Comments

no-avatar

Advertise

HTML Link

Dafont free for download | dafont-free.com

300x250

The fonts presented on this website are their authors' property, and are either freeware, shareware, demo versions or public domain.
The licence mentioned above the download button is just an indication. Please look at the readme-files in the archives or check the indicated author's website for details, and contact him if in doubt.
If no author/licence is indicated that's because we don't have information, that doesn't mean it's free.
Powered by Blog fonts, Version 1.0 | Mobile version